Class b: All beta proteins [48724] (176 folds) |
Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) |
Family b.62.1.0: automated matches [191372] (1 protein) not a true family |
Protein automated matches [190450] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225106] (2 PDB entries) |
Domain d4r3ea_: 4r3e A: [261134] automated match to d2hq6a_ complexed with gol |
PDB Entry: 4r3e (more details), 2 Å
SCOPe Domain Sequences for d4r3ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r3ea_ b.62.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqepptngkvllkttagdidielwskeapkacrnfiqlcleayydntifhrvvpgfivqg gdptgtgsggesiygapfkdefhsrlrfnrrglvamanagshdngsqffftlgradelnn khtifgkvtgdtvynmlrlsevdiddderphnphkikscevlfnpfddiipre
Timeline for d4r3ea_: