Lineage for d4r3ea_ (4r3e A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553283Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1553284Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1553619Family b.62.1.0: automated matches [191372] (1 protein)
    not a true family
  6. 1553620Protein automated matches [190450] (4 species)
    not a true protein
  7. 1553629Species Human (Homo sapiens) [TaxId:9606] [225106] (2 PDB entries)
  8. 1553631Domain d4r3ea_: 4r3e A: [261134]
    automated match to d2hq6a_
    complexed with gol

Details for d4r3ea_

PDB Entry: 4r3e (more details), 2 Å

PDB Description: Structure of the spliceosomal peptidyl-prolyl cis-trans isomerase Cwc27 from Homo sapiens
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase CWC27 homolog

SCOPe Domain Sequences for d4r3ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r3ea_ b.62.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqepptngkvllkttagdidielwskeapkacrnfiqlcleayydntifhrvvpgfivqg
gdptgtgsggesiygapfkdefhsrlrfnrrglvamanagshdngsqffftlgradelnn
khtifgkvtgdtvynmlrlsevdiddderphnphkikscevlfnpfddiipre

SCOPe Domain Coordinates for d4r3ea_:

Click to download the PDB-style file with coordinates for d4r3ea_.
(The format of our PDB-style files is described here.)

Timeline for d4r3ea_: