| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
| Protein automated matches [190197] (23 species) not a true protein |
| Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [226442] (4 PDB entries) |
| Domain d4qytd_: 4qyt D: [261129] automated match to d4gdhb_ complexed with edo, mg |
PDB Entry: 4qyt (more details), 1.05 Å
SCOPe Domain Sequences for d4qytd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qytd_ c.23.16.0 (D:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
vkvclfvadgtdeiefsapwgifkraeipidsvyvgenkdrlvkmsrdvemyanrsykei
psaddfakqydiaiipggglgaktlsttpfvqqvvkefykkpnkwigmicagtltaktsg
lpnkqitghpsvrgqleeggykyldqpvvleenlitsqgpgtamlfglklleqvaskdky
navykslsmp
Timeline for d4qytd_: