Lineage for d4p7eb_ (4p7e B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2984752Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2984753Protein automated matches [190417] (37 species)
    not a true protein
  7. 2984910Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)
  8. 2986545Domain d4p7eb_: 4p7e B: [261126]
    automated match to d2b7ab_
    complexed with 2hb

Details for d4p7eb_

PDB Entry: 4p7e (more details), 2.4 Å

PDB Description: triazolopyridine compounds as selective jak1 inhibitors: from hit identification to glpg0634
PDB Compounds: (B:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d4p7eb_:

Sequence, based on SEQRES records: (download)

>d4p7eb_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdferei
eilkslqhdnivkykgvcysagrrnlklimeylpygslrdylqkhkeridhikllqytsq
ickgmeylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespif
wyapeslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqgqmivfhli
ellknngrlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdqmag

Sequence, based on observed residues (ATOM records): (download)

>d4p7eb_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dptqfeerhlkflqqlgkgnfgsvemcrydplqdntgevvavkklqhsteehlrdferei
eilkslqhdnivkykgvcysnlklimeylpygslrdylqkhkeridhikllqytsqickg
meylgtkryihrdlatrnilvenenrvkigdfgltkvlpqdkeyykvkepgespifwyap
eslteskfsvasdvwsfgvvlyelftyieksksppaefmrmigndkqmivfhliellknn
grlprpdgcpdeiymimtecwnnnvnqrpsfrdlalrvdqirdqmag

SCOPe Domain Coordinates for d4p7eb_:

Click to download the PDB-style file with coordinates for d4p7eb_.
(The format of our PDB-style files is described here.)

Timeline for d4p7eb_: