SCOPe 2.07: Domain d4pvob_: 4pvo B:

Lineage for d4pvob_ (4pvo B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (72 PDB entries)

8. Domain d4pvob_: 4pvo B: [261124]
   automated match to d4fr7a_
   complexed with dms, fmt, s3c, svb, zn

Details for d4pvob_

PDB Entry: 4pvo, 1.48 Å

PDB Description: Crystal Structure of VIM-2 metallo-beta-lactamase in complex with ML302 and ML302F

PDB Compounds: (B:) beta-lactamase class b vim-2

SCOPe Domain Sequences for d4pvob_:

Sequence; same for both SEQRES and ATOM records:

>d4pvob_ d.157.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrsv

Timeline for d4pvob_:

• d4pvob_ first appeared in SCOPe 2.04
  
• d4pvob_ appears in SCOPe 2.06
  
• d4pvob_ appears in the current release, SCOPe 2.08