Lineage for d1qj1.1 (1qj1 A:,B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 802802Protein Thrombin [50531] (2 species)
  7. 802849Species Human (Homo sapiens) [TaxId:9606] [50532] (164 PDB entries)
    Uniprot P00734 331-361,364-421
    Uniprot P00734 334-360 364-510 518-619
    Uniprot P00734 328-620
    Uniprot P00734 355-621
    Uniprot P00734 328-620
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. 802918Domain d1qj1.1: 1qj1 A:,B: [26111]
    complexed with 166

Details for d1qj1.1

PDB Entry: 1qj1 (more details), 2 Å

PDB Description: novel covalent active site thrombin inhibitors
PDB Compounds: (A:) thrombin, (B:) thrombin

SCOP Domain Sequences for d1qj1.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1qj1.1 b.47.1.2 (A:,B:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlek
iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn
lketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdaceg
dsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

SCOP Domain Coordinates for d1qj1.1:

Click to download the PDB-style file with coordinates for d1qj1.1.
(The format of our PDB-style files is described here.)

Timeline for d1qj1.1: