Lineage for d4nqed2 (4nqe D:111-200)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750870Domain d4nqed2: 4nqe D:111-200 [261108]
    Other proteins in same PDB: d4nqea1, d4nqea2, d4nqea3, d4nqeb_, d4nqec1, d4nqec2, d4nqed1, d4nqee1, d4nqee2, d4nqef_, d4nqeg1, d4nqeh1, d4nqeh2
    automated match to d2f54d2
    complexed with 2l4

Details for d4nqed2

PDB Entry: 4nqe (more details), 2.1 Å

PDB Description: crystal structure of tcr-mr1 ternary complex bound to 5-(2- oxoethylideneamino)-6-d-ribitylaminouracil
PDB Compounds: (D:) tcr alpha

SCOPe Domain Sequences for d4nqed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nqed2 b.1.1.2 (D:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d4nqed2:

Click to download the PDB-style file with coordinates for d4nqed2.
(The format of our PDB-style files is described here.)

Timeline for d4nqed2: