Lineage for d4nqee2 (4nqe E:117-244)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765625Domain d4nqee2: 4nqe E:117-244 [261106]
    Other proteins in same PDB: d4nqea1, d4nqeb_, d4nqec1, d4nqed2, d4nqef_
    automated match to d2axhb2
    complexed with 2l4

Details for d4nqee2

PDB Entry: 4nqe (more details), 2.1 Å

PDB Description: crystal structure of tcr-mr1 ternary complex bound to 5-(2- oxoethylideneamino)-6-d-ribitylaminouracil
PDB Compounds: (E:) tcr beta

SCOPe Domain Sequences for d4nqee2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nqee2 b.1.1.0 (E:117-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d4nqee2:

Click to download the PDB-style file with coordinates for d4nqee2.
(The format of our PDB-style files is described here.)

Timeline for d4nqee2: