Lineage for d4nnsa_ (4nns A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1800288Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1800289Protein Adipocyte lipid-binding protein, ALBP [50856] (2 species)
  7. 1800290Species Human (Homo sapiens) [TaxId:9606] [110275] (17 PDB entries)
    Uniprot P15090
  8. 1800300Domain d4nnsa_: 4nns A: [261098]
    automated match to d2hnxa_
    complexed with 75d

Details for d4nnsa_

PDB Entry: 4nns (more details), 1.53 Å

PDB Description: Crystal structure of FABP4 in complex with novel inhibitor
PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d4nnsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nnsa_ b.60.1.2 (A:) Adipocyte lipid-binding protein, ALBP {Human (Homo sapiens) [TaxId: 9606]}
shmcdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestf
knteisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvec
vmkgvtstrvyera

SCOPe Domain Coordinates for d4nnsa_:

Click to download the PDB-style file with coordinates for d4nnsa_.
(The format of our PDB-style files is described here.)

Timeline for d4nnsa_: