SCOPe 2.08: Domain d4nema_: 4nem A:

Lineage for d4nema_ (4nem A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187448] (21 PDB entries)

8. Domain d4nema_: 4nem A: [261094]
   automated match to d2erjd_
   complexed with 2jy

Details for d4nema_

PDB Entry: 4nem, 1.93 Å

PDB Description: Small molecular fragment bound to crystal contact interface of Interleukin-2

PDB Compounds: (A:) interleukin-2

SCOPe Domain Sequences for d4nema_:

Sequence, based on SEQRES records:

>d4nema_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp
leevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwitfs
qsiistlt

Sequence, based on observed residues (ATOM records):

>d4nema_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp
leevlnlaqdlisninvivlelkfmceyadetativeflnrwitfsqsiistlt

Timeline for d4nema_:

• d4nema_ first appeared in SCOPe 2.04
  
• d4nema_ appears in SCOPe 2.07