SCOPe 2.07: Domain d4neja_: 4nej A:

Lineage for d4neja_ (4nej A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 protein domains)

6. Protein automated matches [190501] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187448] (20 PDB entries)

8. Domain d4neja_: 4nej A: [261093]
   automated match to d2erjd_
   complexed with 2k1

Details for d4neja_

PDB Entry: 4nej, 1.92 Å

PDB Description: Small molecular fragment bound to crystal contact interface of Interleukin-2

PDB Compounds: (A:) interleukin-2

SCOPe Domain Sequences for d4neja_:

Sequence, based on SEQRES records:

>d4neja_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeel
kpleevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwit
fsqsiistlt

Sequence, based on observed residues (ATOM records):

>d4neja_ a.26.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssstkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeel
kpleevlnlaqsdlisninvivlelkgfmceyadetativeflnrwitfsqsiistlt

Timeline for d4neja_:

• d4neja_ first appeared in SCOPe 2.04
  
• d4neja_ appears in SCOPe 2.06