Class b: All beta proteins [48724] (180 folds) |
Fold b.100: Sortase [63816] (1 superfamily) barrel, closed; n=8, S=10; mixed sheet; two overside connections |
Superfamily b.100.1: Sortase [63817] (2 families) |
Family b.100.1.1: Sortase [63818] (3 proteins) |
Protein Sortase A [63819] (2 species) |
Species Staphylococcus aureus [TaxId:1280] [63820] (5 PDB entries) Uniprot Q9S446 61-206 |
Domain d2mlma1: 2mlm A:2-148 [261092] Other proteins in same PDB: d2mlma2 automated match to d1ijaa_ complexed with 2w7 |
PDB Entry: 2mlm (more details)
SCOPe Domain Sequences for d2mlma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mlma1 b.100.1.1 (A:2-148) Sortase A {Staphylococcus aureus [TaxId: 1280]} qakpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiag htfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvevldeqkgkdkql tlitcddynektgvwekrkifvatevk
Timeline for d2mlma1: