SCOPe 2.08: Domain d2mlma1: 2mlm A:2-148

Lineage for d2mlma1 (2mlm A:2-148)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.100: Sortase [63816] (1 superfamily)
   barrel, closed; n=8, S=10; mixed sheet; two overside connections

4. Superfamily b.100.1: Sortase [63817] (2 families)

5. Family b.100.1.1: Sortase [63818] (3 proteins)

6. Protein Sortase A [63819] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [63820] (5 PDB entries)
   Uniprot Q9S446 61-206

8. Domain d2mlma1: 2mlm A:2-148 [261092]
   Other proteins in same PDB: d2mlma2
   automated match to d1ijaa_
   complexed with 2w7

Details for d2mlma1

PDB Entry: 2mlm

PDB Description: solution structure of sortase a from s. aureus in complex with benzo[d]isothiazol-3-one based inhibitor

PDB Compounds: (A:) Sortase family protein

SCOPe Domain Sequences for d2mlma1:

Sequence; same for both SEQRES and ATOM records:

>d2mlma1 b.100.1.1 (A:2-148) Sortase A {Staphylococcus aureus [TaxId: 1280]}
qakpqipkdkskvagyieipdadikepvypgpatpeqlnrgvsfaeeneslddqnisiag
htfidrpnyqftnlkaakkgsmvyfkvgnetrkykmtsirdvkptdvevldeqkgkdkql
tlitcddynektgvwekrkifvatevk

Timeline for d2mlma1:

• d2mlma1 first appeared in SCOPe 2.04, called d2mlma_
  
• d2mlma1 appears in SCOPe 2.07