Lineage for d4kxkc_ (4kxk C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1613596Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 1613784Protein automated matches [190399] (9 species)
    not a true protein
  7. 1613802Species Human (Homo sapiens) [TaxId:9606] [189951] (7 PDB entries)
  8. 1613812Domain d4kxkc_: 4kxk C: [261080]
    Other proteins in same PDB: d4kxkb_, d4kxkd_
    automated match to d3r9ac_
    complexed with bme, so4

Details for d4kxkc_

PDB Entry: 4kxk (more details), 2.9 Å

PDB Description: Alanine-glyoxylate aminotransferase variant K390A/K391A in complex with the TPR domain of human Pex5p
PDB Compounds: (C:) Serine--pyruvate aminotransferase

SCOPe Domain Sequences for d4kxkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kxkc_ c.67.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llvtppkallkplsipnqlllgpgpsnlpprimaagglqmigsmskdmyqimdeikegiq
yvfqtrnpltlvisgsghcaleaalvnvlepgdsflvgangiwgqravdigerigarvhp
mtkdpgghytlqeveeglaqhkpvllflthgesstgvlqpldgfgelchrykclllvdsv
aslggtplymdrqgidilysgsqkalnappgtslisfsdkakkkmysrktkpfsfyldik
wlanfwgcddqprmyhhtipvislyslreslaliaeqglenswrqhreaaaylhgrlqal
glqlfvkdpalrlptvttvavpagydwrdivsyvidhfdieimgglgpstgkvlrigllg
cnatrenvdrvtealraalqhcpkaal

SCOPe Domain Coordinates for d4kxkc_:

Click to download the PDB-style file with coordinates for d4kxkc_.
(The format of our PDB-style files is described here.)

Timeline for d4kxkc_: