![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
![]() | Protein Alanine-glyoxylate aminotransferase [89757] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89758] (12 PDB entries) |
![]() | Domain d4kxka_: 4kxk A: [261079] Other proteins in same PDB: d4kxkb_, d4kxkd_ automated match to d3r9ac_ complexed with bme, so4 |
PDB Entry: 4kxk (more details), 2.9 Å
SCOPe Domain Sequences for d4kxka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kxka_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} llvtppkallkplsipnqlllgpgpsnlpprimaagglqmigsmskdmyqimdeikegiq yvfqtrnpltlvisgsghcaleaalvnvlepgdsflvgangiwgqravdigerigarvhp mtkdpgghytlqeveeglaqhkpvllflthgesstgvlqpldgfgelchrykclllvdsv aslggtplymdrqgidilysgsqkalnappgtslisfsdkakkkmysrktkpfsfyldik wlanfwgcddqprmyhhtipvislyslreslaliaeqglenswrqhreaaaylhgrlqal glqlfvkdpalrlptvttvavpagydwrdivsyvidhfdieimgglgpstgkvlrigllg cnatrenvdrvtealraalqhcpkaal
Timeline for d4kxka_: