Lineage for d4junc1 (4jun C:11-323)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040468Domain d4junc1: 4jun C:11-323 [261077]
    Other proteins in same PDB: d4juna2, d4junb_, d4junc2, d4jund_, d4june2, d4junf_
    automated match to d4bh4a_
    complexed with epe, nag

Details for d4junc1

PDB Entry: 4jun (more details), 2.34 Å

PDB Description: Crystal structure of H5N1 influenza virus hemagglutinin, clade 5
PDB Compounds: (C:) hemagglutinin HA1

SCOPe Domain Sequences for d4junc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4junc1 b.19.1.2 (C:11-323) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpicdefinvpewsyivekaspandlcypgdfndyeelkhllsrinhfekiqiipks
swsnheassgvssacpyqgrpsffrnvvwlikknsayptikrsynntsqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvkssrlvlatglrns

SCOPe Domain Coordinates for d4junc1:

Click to download the PDB-style file with coordinates for d4junc1.
(The format of our PDB-style files is described here.)

Timeline for d4junc1: