Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (36 species) not a true protein |
Species Influenza A virus [TaxId:365085] [256809] (1 PDB entry) |
Domain d4junf_: 4jun F: [261076] Other proteins in same PDB: d4juna1, d4juna2, d4junc1, d4junc2, d4june1, d4june2 automated match to d4n5zb_ complexed with epe, nag |
PDB Entry: 4jun (more details), 2.34 Å
SCOPe Domain Sequences for d4junf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4junf_ h.3.1.1 (F:) automated matches {Influenza A virus [TaxId: 365085]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd rvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseea
Timeline for d4junf_: