Lineage for d4junf_ (4jun F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3041482Protein automated matches [254646] (29 species)
    not a true protein
  7. 3041613Species Influenza A virus [TaxId:365085] [256809] (1 PDB entry)
  8. 3041616Domain d4junf_: 4jun F: [261076]
    Other proteins in same PDB: d4juna1, d4juna2, d4junc1, d4junc2, d4june1, d4june2
    automated match to d4n5zb_
    complexed with epe, nag

Details for d4junf_

PDB Entry: 4jun (more details), 2.34 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, clade 5
PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d4junf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4junf_ h.3.1.1 (F:) automated matches {Influenza A virus [TaxId: 365085]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
rvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseea

SCOPe Domain Coordinates for d4junf_:

Click to download the PDB-style file with coordinates for d4junf_.
(The format of our PDB-style files is described here.)

Timeline for d4junf_: