Lineage for d4jund_ (4jun D:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1969577Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1969578Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1969579Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1969953Protein automated matches [254646] (33 species)
    not a true protein
  7. 1970138Species Influenza a virus [TaxId:365085] [256809] (1 PDB entry)
  8. 1970140Domain d4jund_: 4jun D: [261075]
    Other proteins in same PDB: d4juna_, d4junc_, d4june_
    automated match to d4n5zb_
    complexed with epe, nag

Details for d4jund_

PDB Entry: 4jun (more details), 2.34 Å

PDB Description: Crystal structure of H5N1 influenza virus hemagglutinin, clade 5
PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d4jund_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jund_ h.3.1.1 (D:) automated matches {Influenza a virus [TaxId: 365085]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
rvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyse

SCOPe Domain Coordinates for d4jund_:

Click to download the PDB-style file with coordinates for d4jund_.
(The format of our PDB-style files is described here.)

Timeline for d4jund_: