SCOPe 2.05: Domain d4jund_: 4jun D:

Lineage for d4jund_ (4jun D:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (33 species)
   not a true protein

7. Species Influenza a virus [TaxId:365085] [256809] (1 PDB entry)

8. Domain d4jund_: 4jun D: [261075]
   Other proteins in same PDB: d4juna_, d4junc_, d4june_
   automated match to d4n5zb_
   complexed with epe, nag

Details for d4jund_

PDB Entry: 4jun, 2.34 Å

PDB Description: crystal structure of h5n1 influenza virus hemagglutinin, clade 5

PDB Compounds: (D:) hemagglutinin HA2

SCOPe Domain Sequences for d4jund_:

Sequence; same for both SEQRES and ATOM records:

>d4jund_ h.3.1.1 (D:) automated matches {Influenza a virus [TaxId: 365085]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
rvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyse

Timeline for d4jund_:

• d4jund_ first appeared in SCOPe 2.04
  
• d4jund_ appears in SCOPe 2.06
  
• d4jund_ appears in the current release, SCOPe 2.08