Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (29 species) not a true protein |
Species Influenza A virus [TaxId:365085] [256809] (1 PDB entry) |
Domain d4jund_: 4jun D: [261075] Other proteins in same PDB: d4juna1, d4juna2, d4junc1, d4junc2, d4june1, d4june2 automated match to d4n5zb_ complexed with epe, nag |
PDB Entry: 4jun (more details), 2.34 Å
SCOPe Domain Sequences for d4jund_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jund_ h.3.1.1 (D:) automated matches {Influenza A virus [TaxId: 365085]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd rvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyse
Timeline for d4jund_: