SCOPe 2.07: Domain d4cima_: 4cim A:

Lineage for d4cima_ (4cim A:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (88 PDB entries)

8. Domain d4cima_: 4cim A: [261068]
   automated match to d1zy3a1
   complexed with edo; mutant

Details for d4cima_

PDB Entry: 4cim, 1.5 Å

PDB Description: Complex of a Bcl-w BH3 mutant with a BH3 domain

PDB Compounds: (A:) bcl-2-like protein 2

SCOPe Domain Sequences for d4cima_:

Sequence; same for both SEQRES and ATOM records:

>d4cima_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apdtralvadfvgyklrqkgyvsgagpgegpaadplgqalraigdefetrfrrtfsdlaa
qlhvtpgsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkemeplvgqvqewm
veyletrladwihssggwaeftalyg

Timeline for d4cima_:

• d4cima_ first appeared in SCOPe 2.04
  
• d4cima_ appears in SCOPe 2.06
  
• d4cima_ appears in the current release, SCOPe 2.08