Lineage for d3wwgb1 (3wwg B:20-184)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824608Fold b.133: Dextranase, N-terminal domain [101595] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2824609Superfamily b.133.1: Dextranase, N-terminal domain [101596] (2 families) (S)
  5. 2824615Family b.133.1.0: automated matches [261054] (1 protein)
    not a true family
  6. 2824616Protein automated matches [261055] (1 species)
    not a true protein
  7. 2824617Species Aspergillus niger [TaxId:5061] [261056] (4 PDB entries)
  8. 2824623Domain d3wwgb1: 3wwg B:20-184 [261063]
    Other proteins in same PDB: d3wwga2, d3wwga3, d3wwgb2, d3wwgb3, d3wwgc2, d3wwgc3, d3wwgd2, d3wwgd3
    automated match to d1ogox1
    complexed with nag

Details for d3wwgb1

PDB Entry: 3wwg (more details), 2.2 Å

PDB Description: crystal structure of the n-glycan-deficient variant n448a of isopullulanase complexed with isopanose
PDB Compounds: (B:) Isopullulanase

SCOPe Domain Sequences for d3wwgb1:

Sequence, based on SEQRES records: (download)

>d3wwgb1 b.133.1.0 (B:20-184) automated matches {Aspergillus niger [TaxId: 5061]}
avtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvylaip
gngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvrydnq
svyitvpysptgyrfsvefdddlislapsgarqpenallifaspf

Sequence, based on observed residues (ATOM records): (download)

>d3wwgb1 b.133.1.0 (B:20-184) automated matches {Aspergillus niger [TaxId: 5061]}
avtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvylaip
gngmsdqlqytqgynqtqawtsflyshdatvkisrngsansnvvirptslnfpvrydnqs
vyitvpysptgyrfsvefdddlislapsgarqpenallifaspf

SCOPe Domain Coordinates for d3wwgb1:

Click to download the PDB-style file with coordinates for d3wwgb1.
(The format of our PDB-style files is described here.)

Timeline for d3wwgb1: