![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
![]() | Protein automated matches [190135] (18 species) not a true protein |
![]() | Species Uncultured bacterium [TaxId:77133] [261060] (2 PDB entries) |
![]() | Domain d3wx5a_: 3wx5 A: [261062] automated match to d1h0ba_ |
PDB Entry: 3wx5 (more details), 1.85 Å
SCOPe Domain Sequences for d3wx5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wx5a_ b.29.1.11 (A:) automated matches {Uncultured bacterium [TaxId: 77133]} deptatvcdrwgsrdvaggryrvinnvwgaetaqcieigletgnfiltraehsngdnvaa ypaiylgchwgactsqsglplrveaisrlqsnwrltpissgrwnaaydlwfspsltstng ysggaelmiwlnwrgnvmpggnrvatvslagatwevwfadwdwnyiayrrttpvtevtql dlkafiddavargyisptwylhavetgfelweggrglkssdfsvtltar
Timeline for d3wx5a_: