SCOPe 2.04: Domain d3wx5b_: 3wx5 B:

Lineage for d3wx5b_ (3wx5 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein automated matches [190135] (9 species)
   not a true protein

7. Species Uncultured bacterium [TaxId:77133] [261060] (1 PDB entry)

8. Domain d3wx5b_: 3wx5 B: [261061]
   automated match to d1h0ba_

Details for d3wx5b_

PDB Entry: 3wx5, 1.85 Å

PDB Description: Crystal structure of metagenome-derived glycoside hydrolase family 12 endoglucanase

PDB Compounds: (B:) cellulase

SCOPe Domain Sequences for d3wx5b_:

Sequence; same for both SEQRES and ATOM records:

>d3wx5b_ b.29.1.11 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
deptatvcdrwgsrdvaggryrvinnvwgaetaqcieigletgnfiltraehsngdnvaa
ypaiylgchwgactsqsglplrveaisrlqsnwrltpissgrwnaaydlwfspsltstng
ysggaelmiwlnwrgnvmpggnrvatvslagatwevwfadwdwnyiayrrttpvtevtql
dlkafiddavargyisptwylhavetgfelweggrglkssdfsvtltar

Timeline for d3wx5b_:

• d3wx5b_ is new in SCOPe 2.04-stable
  
• d3wx5b_ appears in SCOPe 2.05
  
• d3wx5b_ appears in the current release, SCOPe 2.08