Lineage for d3wx5b_ (3wx5 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780055Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2780261Protein automated matches [190135] (18 species)
    not a true protein
  7. 2780336Species Uncultured bacterium [TaxId:77133] [261060] (2 PDB entries)
  8. 2780338Domain d3wx5b_: 3wx5 B: [261061]
    automated match to d1h0ba_

Details for d3wx5b_

PDB Entry: 3wx5 (more details), 1.85 Å

PDB Description: Crystal structure of metagenome-derived glycoside hydrolase family 12 endoglucanase
PDB Compounds: (B:) cellulase

SCOPe Domain Sequences for d3wx5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wx5b_ b.29.1.11 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
deptatvcdrwgsrdvaggryrvinnvwgaetaqcieigletgnfiltraehsngdnvaa
ypaiylgchwgactsqsglplrveaisrlqsnwrltpissgrwnaaydlwfspsltstng
ysggaelmiwlnwrgnvmpggnrvatvslagatwevwfadwdwnyiayrrttpvtevtql
dlkafiddavargyisptwylhavetgfelweggrglkssdfsvtltar

SCOPe Domain Coordinates for d3wx5b_:

Click to download the PDB-style file with coordinates for d3wx5b_.
(The format of our PDB-style files is described here.)

Timeline for d3wx5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3wx5a_