Lineage for d3wwgc1 (3wwg C:18-184)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1814335Fold b.133: Dextranase, N-terminal domain [101595] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 1814336Superfamily b.133.1: Dextranase, N-terminal domain [101596] (2 families) (S)
  5. 1814342Family b.133.1.0: automated matches [261054] (1 protein)
    not a true family
  6. 1814343Protein automated matches [261055] (1 species)
    not a true protein
  7. 1814344Species Aspergillus niger [TaxId:5061] [261056] (4 PDB entries)
  8. 1814353Domain d3wwgc1: 3wwg C:18-184 [261057]
    Other proteins in same PDB: d3wwga2, d3wwgb2, d3wwgc2, d3wwgd2
    automated match to d1ogox1
    complexed with mal, nag

Details for d3wwgc1

PDB Entry: 3wwg (more details), 2.2 Å

PDB Description: crystal structure of the n-glycan-deficient variant n448a of isopullulanase complexed with isopanose
PDB Compounds: (C:) Isopullulanase

SCOPe Domain Sequences for d3wwgc1:

Sequence, based on SEQRES records: (download)

>d3wwgc1 b.133.1.0 (C:18-184) automated matches {Aspergillus niger [TaxId: 5061]}
fmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttpassslyydsfvyla
ipgngmsdqlqytqgynqtqawtsflyshdatvkisrngssansnvvirptslnfpvryd
nqsvyitvpysptgyrfsvefdddlislapsgarqpenallifaspf

Sequence, based on observed residues (ATOM records): (download)

>d3wwgc1 b.133.1.0 (C:18-184) automated matches {Aspergillus niger [TaxId: 5061]}
fmavtannsqlltwwhntgeintqtpvadgnvrqsglysvkvqttplyydsfvylaipgn
gmsdqlqytqgynqtqawtsflyshdatvkisrnsansnvvirptslnfpvrydnqsvyi
tvpysptgyrfsvefdddlislapsgarqpenallifaspf

SCOPe Domain Coordinates for d3wwgc1:

Click to download the PDB-style file with coordinates for d3wwgc1.
(The format of our PDB-style files is described here.)

Timeline for d3wwgc1: