SCOPe 2.05: Domain d3wu4d_: 3wu4 D:

Lineage for d3wu4d_ (3wu4 D:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.10: ATP-dependent protease Lon (La), catalytic domain [102769] (1 protein)
   contains extra C-terminal alpha/beta subdomain
   automatically mapped to Pfam PF05362

6. Protein ATP-dependent protease Lon (La), catalytic domain [102770] (2 species)

7. Species Escherichia coli [TaxId:562] [102771] (6 PDB entries)

8. Domain d3wu4d_: 3wu4 D: [261048]
   automated match to d1rrea_
   complexed with so4

Details for d3wu4d_

PDB Entry: 3wu4, 1.7 Å

PDB Description: oxidized-form structure of e.coli lon proteolytic domain

PDB Compounds: (D:) Lon protease

SCOPe Domain Sequences for d3wu4d_:

Sequence; same for both SEQRES and ATOM records:

>d3wu4d_ d.14.1.10 (D:) ATP-dependent protease Lon (La), catalytic domain {Escherichia coli [TaxId: 562]}
rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn
ep

Timeline for d3wu4d_:

• d3wu4d_ first appeared in SCOPe 2.04
  
• d3wu4d_ appears in SCOPe 2.06
  
• d3wu4d_ appears in the current release, SCOPe 2.08