Lineage for d1c1w.1 (1c1w L:,H:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. Protein Thrombin [50531] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [50532] (171 PDB entries)
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. Domain d1c1w.1: 1c1w L:,H: [26104]
    complexed with bah, na, zn

Details for d1c1w.1

PDB Entry: 1c1w (more details), 1.9 Å

PDB Description: recruiting zinc to mediate potent, specific inhibition of serine proteases
PDB Compounds: (H:) Thrombin heavy chain, (L:) Thrombin light chain

SCOPe Domain Sequences for d1c1w.1:

Sequence, based on SEQRES records: (download)

>g1c1w.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlek
iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn
lketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdaceg
dsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

Sequence, based on observed residues (ATOM records): (download)

>g1c1w.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlek
iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn
lketgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfv
mkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

SCOPe Domain Coordinates for d1c1w.1 are not available.

Timeline for d1c1w.1: