Lineage for d3wu6f_ (3wu6 F:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2177010Family d.14.1.10: ATP-dependent protease Lon (La), catalytic domain [102769] (1 protein)
    contains extra C-terminal alpha/beta subdomain
    automatically mapped to Pfam PF05362
  6. 2177011Protein ATP-dependent protease Lon (La), catalytic domain [102770] (2 species)
  7. 2177012Species Escherichia coli [TaxId:562] [102771] (6 PDB entries)
  8. 2177036Domain d3wu6f_: 3wu6 F: [261036]
    automated match to d1rrea_
    complexed with so4

Details for d3wu6f_

PDB Entry: 3wu6 (more details), 1.8 Å

PDB Description: oxidized e.coli lon proteolytic domain
PDB Compounds: (F:) Lon protease

SCOPe Domain Sequences for d3wu6f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wu6f_ d.14.1.10 (F:) ATP-dependent protease Lon (La), catalytic domain {Escherichia coli [TaxId: 562]}
rvgqvtglawtevggdlltietacvpgkgkltytgslgevmqesiqaaltvvraraeklg
inpdfyekrdihvhvpegatpkdgpaagiamctalvscltgnpvradvamtgeitlrgqv
lpigglkekllaahrggiktvlipfenkrdleeipdnviadldihpvkrieevltlalqn

SCOPe Domain Coordinates for d3wu6f_:

Click to download the PDB-style file with coordinates for d3wu6f_.
(The format of our PDB-style files is described here.)

Timeline for d3wu6f_: