SCOPe 2.04: Domain d4wuob_: 4wuo B:

Lineage for d4wuob_ (4wuo B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (18 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [189081] (6 PDB entries)

8. Domain d4wuob_: 4wuo B: [261028]
   automated match to d2y3za_
   complexed with eoh, gol, ipm, k, mn, nad; mutant

Details for d4wuob_

PDB Entry: 4wuo, 2.05 Å

PDB Description: Structure of the E270A Mutant Isopropylmalate dehydrogenase from Thermus thermophilus in complex with IPM, Mn and NADH

PDB Compounds: (B:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d4wuob_:

Sequence; same for both SEQRES and ATOM records:

>d4wuob_ c.77.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv
vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
dilsdlasvlpgslgllpsaslgrgtpvfapvhgsapdiagkgianptaailsaammleh
afglvelarkvedavakalletpppdlggsagteaftatvlrhla

Timeline for d4wuob_:

• d4wuob_ is new in SCOPe 2.04-stable
  
• d4wuob_ appears in SCOPe 2.05
  
• d4wuob_ appears in the current release, SCOPe 2.08