Lineage for d4wuoa1 (4wuo A:1-345)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2905793Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
    the active site is between the two identical subunits
  6. 2905990Protein automated matches [190072] (22 species)
    not a true protein
  7. 2906126Species Thermus thermophilus [TaxId:274] [189081] (6 PDB entries)
  8. 2906128Domain d4wuoa1: 4wuo A:1-345 [261027]
    Other proteins in same PDB: d4wuoa2, d4wuoa3
    automated match to d2y3za_
    complexed with eoh, gol, ipm, k, mn, nad; mutant

Details for d4wuoa1

PDB Entry: 4wuo (more details), 2.05 Å

PDB Description: Structure of the E270A Mutant Isopropylmalate dehydrogenase from Thermus thermophilus in complex with IPM, Mn and NADH
PDB Compounds: (A:) 3-isopropylmalate dehydrogenase

SCOPe Domain Sequences for d4wuoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wuoa1 c.77.1.1 (A:1-345) automated matches {Thermus thermophilus [TaxId: 274]}
mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv
vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
dilsdlasvlpgslgllpsaslgrgtpvfapvhgsapdiagkgianptaailsaammleh
afglvelarkvedavakalletpppdlggsagteaftatvlrhla

SCOPe Domain Coordinates for d4wuoa1:

Click to download the PDB-style file with coordinates for d4wuoa1.
(The format of our PDB-style files is described here.)

Timeline for d4wuoa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d4wuob_