![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
![]() | Protein automated matches [226868] (6 species) not a true protein |
![]() | Species Freesia hybrid [TaxId:867926] [261021] (1 PDB entry) |
![]() | Domain d4wumc1: 4wum C:1-235 [261022] Other proteins in same PDB: d4wuma2, d4wumb2, d4wumc2, d4wumd2 automated match to d1cmla1 |
PDB Entry: 4wum (more details), 1.77 Å
SCOPe Domain Sequences for d4wumc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wumc1 c.95.1.2 (C:1-235) automated matches {Freesia hybrid [TaxId: 867926]} mvnveeirkaqraegpaailaigtatppnaieqseypdyyfrvtnsedkvelkekfkrmc eksmikkrylyltedilkenpnvcaymatsldarqdmvvvevpklgkeaatraikewgqp kskithlvfcttsgvdmpgadyqltkllglrpsvkrlmmyqqgcfaggtvlrlakdlaen nrgarvlvvcseitavtfrgpseshldslvgqalfgdgaaalivgsdaiegierp
Timeline for d4wumc1: