SCOPe 2.05: Domain d4wtod2: 4wto D:101-153

Lineage for d4wtod2 (4wto D:101-153)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families)
   automatically mapped to Pfam PF02748

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (3 species)

7. Species Escherichia coli [TaxId:562] [57828] (60 PDB entries)
   Uniprot P00478

8. Domain d4wtod2: 4wto D:101-153 [261020]
   Other proteins in same PDB: d4wtoa1, d4wtoa2, d4wtob1, d4wtoc1, d4wtoc2, d4wtod1
   automated match to d1d09b2

Details for d4wtod2

PDB Entry: 4wto, 2.03 Å

PDB Description: natural source aspartate carbamoyltransferase in e.coil (ligand-free and zinc-free)

PDB Compounds: (D:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4wtod2:

Sequence; same for both SEQRES and ATOM records:

>d4wtod2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli [TaxId: 562]}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d4wtod2:

• d4wtod2 first appeared in SCOPe 2.04
  
• d4wtod2 appears in SCOPe 2.06
  
• d4wtod2 last appears in SCOPe 2.07