SCOPe 2.07: Domain d4wtob1: 4wto B:1-100

Lineage for d4wtob1 (4wto B:1-100)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families)
   automatically mapped to Pfam PF01948

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (3 species)

7. Species Escherichia coli [TaxId:562] [54896] (63 PDB entries)
   Uniprot P00478

8. Domain d4wtob1: 4wto B:1-100 [261017]
   Other proteins in same PDB: d4wtoa1, d4wtoa2, d4wtob2, d4wtoc1, d4wtoc2, d4wtod2
   automated match to d1d09b1

Details for d4wtob1

PDB Entry: 4wto, 2.03 Å

PDB Description: natural source aspartate carbamoyltransferase in e.coil (ligand-free and zinc-free)

PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d4wtob1:

Sequence; same for both SEQRES and ATOM records:

>d4wtob1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

Timeline for d4wtob1:

• d4wtob1 first appeared in SCOPe 2.04
  
• d4wtob1 appears in SCOPe 2.06
  
• d4wtob1 does not appear in SCOPe 2.08