Lineage for d4wtoa1 (4wto A:1-150)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2513850Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2513851Protein Aspartate carbamoyltransferase catalytic subunit [53673] (7 species)
  7. 2513859Species Escherichia coli [TaxId:562] [53674] (63 PDB entries)
    Uniprot P00479
  8. 2513958Domain d4wtoa1: 4wto A:1-150 [261015]
    Other proteins in same PDB: d4wtob1, d4wtob2, d4wtod1, d4wtod2
    automated match to d1f1ba1

Details for d4wtoa1

PDB Entry: 4wto (more details), 2.03 Å

PDB Description: natural source aspartate carbamoyltransferase in e.coil (ligand-free and zinc-free)
PDB Compounds: (A:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d4wtoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wtoa1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOPe Domain Coordinates for d4wtoa1:

Click to download the PDB-style file with coordinates for d4wtoa1.
(The format of our PDB-style files is described here.)

Timeline for d4wtoa1: