Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (59 species) not a true protein |
Species Burkholderia thailandensis [TaxId:271848] [189811] (3 PDB entries) |
Domain d4wsoa_: 4wso A: [261007] automated match to d1yuma_ complexed with nad, po4 |
PDB Entry: 4wso (more details), 2.05 Å
SCOPe Domain Sequences for d4wsoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wsoa_ c.26.1.0 (A:) automated matches {Burkholderia thailandensis [TaxId: 271848]} lpalprrigilggtfdpihdghlalarrfadvlrltelvlmpagqpyqkqdvsaaehrla mtraaagslvlpgvavsvatdeiehagptytvetlerwrerlgadaslslligadqlvrl dtwrdwrrlfdfahvcaatrpgfdfaaaspavaaeiasrqasadvlratpagrllidttl aldvaatdirahlraciarhaqvpdasaehvspavwayilqhrlyhp
Timeline for d4wsoa_: