![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.70: Nucleoside hydrolase [53589] (1 superfamily) core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest |
![]() | Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) ![]() |
![]() | Family c.70.1.0: automated matches [191403] (1 protein) not a true family |
![]() | Protein automated matches [190539] (7 species) not a true protein |
![]() | Species Shewanella loihica [TaxId:323850] [261005] (1 PDB entry) |
![]() | Domain d4wr2a_: 4wr2 A: [261006] automated match to d3g5id_ complexed with 1pe, ca |
PDB Entry: 4wr2 (more details), 1.7 Å
SCOPe Domain Sequences for d4wr2a_:
Sequence, based on SEQRES records: (download)
>d4wr2a_ c.70.1.0 (A:) automated matches {Shewanella loihica [TaxId: 323850]} kairplasatpiildcdpghddaislilalsserlnplavttsagnqtpdktlnnalril tllnradmpvaggavkplareliiadnvhgesgldgpklpdpsfdpltqnaielmaekvr qsavpvtlvpsgpltnialfianypelhskverivlmggaagvgnwtpaaefnifvdpea admvfksgipitmcgldvtheaqimdedieriraipnpvaqcvaelldffmiyhrdpkwg ftgaplhdpctiawllkpelftaqecwvgvetkgeytqgmtvvdryqltgktanatvlfd ldrqgfvdlivdclsayn
>d4wr2a_ c.70.1.0 (A:) automated matches {Shewanella loihica [TaxId: 323850]} kairplasatpiildcdpghddaislilalsserlnplavttsagnqtpdktlnnalril tllnradmpvaggavkplareliiagpklpdpsfdpltqnaielmaekvrqsavpvtlvp sgpltnialfianypelhskverivlmggaagvgnwtpaaefnifvdpeaadmvfksgip itmcgldvtheaqimdedieriraipnpvaqcvaelldffmiyhrdpkwgftgaplhdpc tiawllkpelftaqecwvgvetkgeytqgmtvvdryqltgktanatvlfdldrqgfvdli vdclsayn
Timeline for d4wr2a_: