Lineage for d4wr2a_ (4wr2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136733Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 2136734Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) (S)
  5. 2136800Family c.70.1.0: automated matches [191403] (1 protein)
    not a true family
  6. 2136801Protein automated matches [190539] (5 species)
    not a true protein
  7. 2136816Species Shewanella loihica [TaxId:323850] [261005] (1 PDB entry)
  8. 2136817Domain d4wr2a_: 4wr2 A: [261006]
    automated match to d3g5id_
    complexed with 1pe, ca

Details for d4wr2a_

PDB Entry: 4wr2 (more details), 1.7 Å

PDB Description: crystal structure of a putative pyrimidine-specific ribonucleoside hydrolase (riha) protein from shewanella loihica pv-4 (shew_0697, target psi-029635) with divalent cation and peg 400 bound at the active site
PDB Compounds: (A:) Pyrimidine-specific ribonucleoside hydrolase rihA

SCOPe Domain Sequences for d4wr2a_:

Sequence, based on SEQRES records: (download)

>d4wr2a_ c.70.1.0 (A:) automated matches {Shewanella loihica [TaxId: 323850]}
kairplasatpiildcdpghddaislilalsserlnplavttsagnqtpdktlnnalril
tllnradmpvaggavkplareliiadnvhgesgldgpklpdpsfdpltqnaielmaekvr
qsavpvtlvpsgpltnialfianypelhskverivlmggaagvgnwtpaaefnifvdpea
admvfksgipitmcgldvtheaqimdedieriraipnpvaqcvaelldffmiyhrdpkwg
ftgaplhdpctiawllkpelftaqecwvgvetkgeytqgmtvvdryqltgktanatvlfd
ldrqgfvdlivdclsayn

Sequence, based on observed residues (ATOM records): (download)

>d4wr2a_ c.70.1.0 (A:) automated matches {Shewanella loihica [TaxId: 323850]}
kairplasatpiildcdpghddaislilalsserlnplavttsagnqtpdktlnnalril
tllnradmpvaggavkplareliiagpklpdpsfdpltqnaielmaekvrqsavpvtlvp
sgpltnialfianypelhskverivlmggaagvgnwtpaaefnifvdpeaadmvfksgip
itmcgldvtheaqimdedieriraipnpvaqcvaelldffmiyhrdpkwgftgaplhdpc
tiawllkpelftaqecwvgvetkgeytqgmtvvdryqltgktanatvlfdldrqgfvdli
vdclsayn

SCOPe Domain Coordinates for d4wr2a_:

Click to download the PDB-style file with coordinates for d4wr2a_.
(The format of our PDB-style files is described here.)

Timeline for d4wr2a_: