Lineage for d4wjzb1 (4wjz B:5-246)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2849251Species Vibrio cholerae [TaxId:243277] [261002] (1 PDB entry)
  8. 2849253Domain d4wjzb1: 4wjz B:5-246 [261004]
    Other proteins in same PDB: d4wjza2, d4wjzb2, d4wjzc2, d4wjzd2
    automated match to d4ag3c_
    complexed with po4

Details for d4wjzb1

PDB Entry: 4wjz (more details), 2.4 Å

PDB Description: crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg)(g141a) from vibrio cholerae
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] reductase FabG

SCOPe Domain Sequences for d4wjzb1:

Sequence, based on SEQRES records: (download)

>d4wjzb1 c.2.1.0 (B:5-246) automated matches {Vibrio cholerae [TaxId: 243277]}
mnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgmalnv
tnpesieavlkaitdefggvdilvnnagitrdnllmrmkeeewsdimetnltsifrlska
vlrgmmkkrqgriinvasvvgtmgnagqanyaaakagvigftksmarevasrgvtvntva
pgfietdmtkalndeqrtatlaqvpagrlgdpreiasavaflaspeaayitgetlhvngg
my

Sequence, based on observed residues (ATOM records): (download)

>d4wjzb1 c.2.1.0 (B:5-246) automated matches {Vibrio cholerae [TaxId: 243277]}
mnlegkvalvtgasrgigkaiaellaergakvigtatsesgaqaisdylgdngkgmalnv
tnpesieavlkaitdefggvdilvnnawsdimetnltsifrlskavlrgmmkkrqgriin
vasvvganyaaakagvigftksmarevasrgvtvntvapgfietdmteqrtatlaqvpag
rlgdpreiasavaflaspeaayitgetlhvnggmy

SCOPe Domain Coordinates for d4wjzb1:

Click to download the PDB-style file with coordinates for d4wjzb1.
(The format of our PDB-style files is described here.)

Timeline for d4wjzb1: