SCOPe 2.06: Domain d4whaa1: 4wha A:6-149

Lineage for d4whaa1 (4wha A:6-149)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)

6. Protein Plant lipoxigenase [49725] (2 species)

7. Species Soybean (Glycine max), isozyme L1 [TaxId:3847] [49726] (22 PDB entries)

8. Domain d4whaa1: 4wha A:6-149 [261000]
   Other proteins in same PDB: d4whaa2
   automated match to d1ygea2
   complexed with act, edo, fe; mutant

Details for d4whaa1

PDB Entry: 4wha, 1.7 Å

PDB Description: lipoxygenase-1 (soybean) l546a/l754a mutant

PDB Compounds: (A:) Seed linoleate 13S-lipoxygenase-1

SCOPe Domain Sequences for d4whaa1:

Sequence, based on SEQRES records:

>d4whaa1 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelevnpdgsavdnlnaflgrsvslqlisatkadahgkgkvgkdtfle
gintslptlgagesafnihfewdgsmgipgafyiknymqvefflksltleaisnqgtirf
vcnswvyntklyksvriffanhty

Sequence, based on observed residues (ATOM records):

>d4whaa1 b.12.1.1 (A:6-149) Plant lipoxigenase {Soybean (Glycine max), isozyme L1 [TaxId: 3847]}
hkikgtvvlmpknelenlnaflgrsvslqlisatkadahgkgkvgkdtflegintslptl
gagesafnihfewdgsmgipgafyiknymqvefflksltleaistirfvcnswvyntkly
ksvriffanhty

Timeline for d4whaa1:

• d4whaa1 first appeared in SCOPe 2.04
  
• d4whaa1 appears in SCOPe 2.05
  
• d4whaa1 appears in SCOPe 2.07
  
• d4whaa1 appears in the current release, SCOPe 2.08