Lineage for d4wa8a2 (4wa8 A:219-339)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329325Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) (S)
  5. 2329373Family a.60.7.0: automated matches [227268] (1 protein)
    not a true family
  6. 2329374Protein automated matches [227061] (2 species)
    not a true protein
  7. 2329377Species Methanopyrus kandleri [TaxId:190192] [260990] (1 PDB entry)
  8. 2329378Domain d4wa8a2: 4wa8 A:219-339 [260995]
    Other proteins in same PDB: d4wa8a1, d4wa8b2
    automated match to d1b43a1
    complexed with cl

Details for d4wa8a2

PDB Entry: 4wa8 (more details), 2.2 Å

PDB Description: Methanopyrus Kandleri FEN-1 nuclease
PDB Compounds: (A:) flap endonuclease 1

SCOPe Domain Sequences for d4wa8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wa8a2 a.60.7.0 (A:219-339) automated matches {Methanopyrus kandleri [TaxId: 190192]}
esreqlvdlaillgtdynpdgvpgigpkralqlirkygsldelkdtdiwpkierhlpvep
eklrrlflepevtddyeldwdepdeeglveflveerdfsedrvrraverlkealqelrkg
g

SCOPe Domain Coordinates for d4wa8a2:

Click to download the PDB-style file with coordinates for d4wa8a2.
(The format of our PDB-style files is described here.)

Timeline for d4wa8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wa8a1