Class a: All alpha proteins [46456] (286 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) |
Family a.60.7.0: automated matches [227268] (1 protein) not a true family |
Protein automated matches [227061] (2 species) not a true protein |
Species Methanopyrus kandleri [TaxId:190192] [260990] (1 PDB entry) |
Domain d4wa8a2: 4wa8 A:219-339 [260995] Other proteins in same PDB: d4wa8a1 automated match to d1b43a1 complexed with cl |
PDB Entry: 4wa8 (more details), 2.2 Å
SCOPe Domain Sequences for d4wa8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wa8a2 a.60.7.0 (A:219-339) automated matches {Methanopyrus kandleri [TaxId: 190192]} esreqlvdlaillgtdynpdgvpgigpkralqlirkygsldelkdtdiwpkierhlpvep eklrrlflepevtddyeldwdepdeeglveflveerdfsedrvrraverlkealqelrkg g
Timeline for d4wa8a2: