SCOPe 2.05: Domain d4wa8a2: 4wa8 A:219-339

Lineage for d4wa8a2 (4wa8 A:219-339)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families)

5. Family a.60.7.0: automated matches [227268] (1 protein)
   not a true family

6. Protein automated matches [227061] (2 species)
   not a true protein

7. Species Methanopyrus kandleri [TaxId:190192] [260990] (1 PDB entry)

8. Domain d4wa8a2: 4wa8 A:219-339 [260995]
   Other proteins in same PDB: d4wa8a1
   automated match to d1b43a1
   complexed with cl

Details for d4wa8a2

PDB Entry: 4wa8, 2.2 Å

PDB Description: Methanopyrus Kandleri FEN-1 nuclease

PDB Compounds: (A:) flap endonuclease 1

SCOPe Domain Sequences for d4wa8a2:

Sequence; same for both SEQRES and ATOM records:

>d4wa8a2 a.60.7.0 (A:219-339) automated matches {Methanopyrus kandleri [TaxId: 190192]}
esreqlvdlaillgtdynpdgvpgigpkralqlirkygsldelkdtdiwpkierhlpvep
eklrrlflepevtddyeldwdepdeeglveflveerdfsedrvrraverlkealqelrkg
g

Timeline for d4wa8a2:

• d4wa8a2 first appeared in SCOPe 2.04
  
• d4wa8a2 appears in SCOPe 2.06
  
• d4wa8a2 appears in the current release, SCOPe 2.08