SCOPe 2.07: Domain d4wa8a1: 4wa8 A:1-218

Lineage for d4wa8a1 (4wa8 A:1-218)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (3 families)

5. Family c.120.1.0: automated matches [227267] (1 protein)
   not a true family

6. Protein automated matches [227060] (2 species)
   not a true protein

7. Species Methanopyrus kandleri [TaxId:190192] [260992] (1 PDB entry)

8. Domain d4wa8a1: 4wa8 A:1-218 [260994]
   Other proteins in same PDB: d4wa8a2, d4wa8b1
   automated match to d1b43a2
   complexed with cl

Details for d4wa8a1

PDB Entry: 4wa8, 2.2 Å

PDB Description: Methanopyrus Kandleri FEN-1 nuclease

PDB Compounds: (A:) flap endonuclease 1

SCOPe Domain Sequences for d4wa8a1:

Sequence, based on SEQRES records:

>d4wa8a1 c.120.1.0 (A:1-218) automated matches {Methanopyrus kandleri [TaxId: 190192]}
mglaelreliepeetdlralagreiaidafnalyqflttimkdgrplmdsrgritshlng
llyrtvnlveegikpvyvfdgeppdlkretlerrrerkeeameklrraktkeerekyarq
varldeslvedakrlldlmgipwvqapsegeaqcaymarcgdvwatgsqdydsllfgspr
lvrnitivgkrkhphtgeiievkpeimrledvldqlgl

Sequence, based on observed residues (ATOM records):

>d4wa8a1 c.120.1.0 (A:1-218) automated matches {Methanopyrus kandleri [TaxId: 190192]}
mglaelreliepeetdlralagreiaidafnalyqflttimkdgrplmdsrgritshlng
llyrtvnlveegikpvyvfdgeppdlkldeslvedakrlldlmgipwvqapsegeaqcay
marcgdvwatgsqdydsllfgsprlvrnitivgkrkhphtgeiievkpeimrledvldql
gl

Timeline for d4wa8a1:

• d4wa8a1 first appeared in SCOPe 2.04
  
• d4wa8a1 appears in SCOPe 2.06
  
• d4wa8a1 appears in the current release, SCOPe 2.08