Lineage for d4wbaa_ (4wba A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040155Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families) (S)
    not a true superfamily
  5. 3040156Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins)
  6. 3040163Protein automated matches [254616] (6 species)
    not a true protein
  7. 3040201Species Simian rotavirus a/sa11 [TaxId:10923] [260113] (2 PDB entries)
  8. 3040202Domain d4wbaa_: 4wba A: [260993]
    automated match to d2o1ja_
    complexed with gol, po4; mutant

Details for d4wbaa_

PDB Entry: 4wba (more details), 1.8 Å

PDB Description: q/e mutant sa11 nsp4_ccd
PDB Compounds: (A:) non-structural glycoprotein nsp4

SCOPe Domain Sequences for d4wbaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wbaa_ h.1.13.1 (A:) automated matches {Simian rotavirus a/sa11 [TaxId: 10923]}
iekqmdrvvkemrrqlemidklttraieavellkriydkltv

SCOPe Domain Coordinates for d4wbaa_:

Click to download the PDB-style file with coordinates for d4wbaa_.
(The format of our PDB-style files is described here.)

Timeline for d4wbaa_: