![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
![]() | Superfamily h.1.13: Rotavirus nonstructural proteins [58030] (2 families) ![]() not a true superfamily |
![]() | Family h.1.13.1: NSP4 oligomerization domain [58031] (2 proteins) |
![]() | Protein automated matches [254616] (6 species) not a true protein |
![]() | Species Simian rotavirus a/sa11 [TaxId:10923] [260113] (2 PDB entries) |
![]() | Domain d4wbaa_: 4wba A: [260993] automated match to d2o1ja_ complexed with gol, po4; mutant |
PDB Entry: 4wba (more details), 1.8 Å
SCOPe Domain Sequences for d4wbaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wbaa_ h.1.13.1 (A:) automated matches {Simian rotavirus a/sa11 [TaxId: 10923]} iekqmdrvvkemrrqlemidklttraieavellkriydkltv
Timeline for d4wbaa_:
![]() Domains from other chains: (mouse over for more information) d4wbab_, d4wbac_, d4wbad_, d4wbae_ |