![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) ![]() |
![]() | Family a.60.7.0: automated matches [227268] (1 protein) not a true family |
![]() | Protein automated matches [227061] (2 species) not a true protein |
![]() | Species Methanopyrus kandleri [TaxId:190192] [260990] (1 PDB entry) |
![]() | Domain d4wa8b1: 4wa8 B:219-339 [260991] Other proteins in same PDB: d4wa8a1, d4wa8b2 automated match to d1b43a1 complexed with cl |
PDB Entry: 4wa8 (more details), 2.2 Å
SCOPe Domain Sequences for d4wa8b1:
Sequence, based on SEQRES records: (download)
>d4wa8b1 a.60.7.0 (B:219-339) automated matches {Methanopyrus kandleri [TaxId: 190192]} esreqlvdlaillgtdynpdgvpgigpkralqlirkygsldelkdtdiwpkierhlpvep eklrrlflepevtddyeldwdepdeeglveflveerdfsedrvrraverlkealqelrkg g
>d4wa8b1 a.60.7.0 (B:219-339) automated matches {Methanopyrus kandleri [TaxId: 190192]} esreqlvdlaillgtdynpdgvpgigpkralqlirkygsldelkdiwpkierhlpvepek lrrlflepevtddyeldwdepdeeglveflveerdfsedrvrraverlkealqelrkgg
Timeline for d4wa8b1: