SCOPe 2.05: Domain d4uw6a_: 4uw6 A:

Lineage for d4uw6a_ (4uw6 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein automated matches [190029] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186749] (8 PDB entries)

8. Domain d4uw6a_: 4uw6 A: [260989]
   automated match to d3zxfb_
   complexed with vv7

Details for d4uw6a_

PDB Entry: 4uw6, 1.79 Å

PDB Description: Human galectin-7 in complex with a galactose based dendron D3.

PDB Compounds: (A:) galectin-7

SCOPe Domain Sequences for d4uw6a_:

Sequence; same for both SEQRES and ATOM records:

>d4uw6a_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfns
keqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlvev
ggdvqldsvrif

Timeline for d4uw6a_:

• d4uw6a_ first appeared in SCOPe 2.04
  
• d4uw6a_ appears in SCOPe 2.06
  
• d4uw6a_ appears in the current release, SCOPe 2.08