Class b: All beta proteins [48724] (176 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
Protein automated matches [190029] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186749] (8 PDB entries) |
Domain d4uw6a_: 4uw6 A: [260989] automated match to d3zxfb_ complexed with vv7 |
PDB Entry: 4uw6 (more details), 1.79 Å
SCOPe Domain Sequences for d4uw6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uw6a_ b.29.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} phksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfns keqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlvev ggdvqldsvrif
Timeline for d4uw6a_: