| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
| Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
| Protein automated matches [191156] (6 species) not a true protein |
| Species Human immunodeficiency virus type 1 group m subtype b [TaxId:11698] [260980] (2 PDB entries) |
| Domain d4u0fa2: 4u0f A:148-219 [260981] Other proteins in same PDB: d4u0fa1 automated match to d2m8pa2 complexed with 3a8, edo |
PDB Entry: 4u0f (more details), 2.22 Å
SCOPe Domain Sequences for d4u0fa2:
Sequence, based on SEQRES records: (download)
>d4u0fa2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq
>d4u0fa2 a.28.3.0 (A:148-219) automated matches {Human immunodeficiency virus type 1 group m subtype b [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraetllvqnanpdcktilkalgpgatleemmtacq
Timeline for d4u0fa2: