Class a: All alpha proteins [46456] (289 folds) |
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) |
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
Protein HIV-1 capsid protein [47945] (1 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries) |
Domain d4u0fa1: 4u0f A:1-147 [260979] Other proteins in same PDB: d4u0fa2 automated match to d2m8lb1 complexed with 3a8, edo |
PDB Entry: 4u0f (more details), 2.22 Å
SCOPe Domain Sequences for d4u0fa1:
Sequence, based on SEQRES records: (download)
>d4u0fa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]} pivqnlqgqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvg ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth nppipvgeiykrwiilglnkivrmysp
>d4u0fa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]} pivqnqmvhqcisprtlnawvkvveekafspevipmfsalscgatpqdlntmlntvgghq aamqmlketineeaaewdrlhpvhiapgqmreprgsdiagttstlqeqigwmthnppipv geiykrwiilglnkivrmysp
Timeline for d4u0fa1: