Lineage for d4tvfa_ (4tvf A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005530Species Actinoplanes teichomyceticus [TaxId:1867] [189592] (5 PDB entries)
  8. 2005532Domain d4tvfa_: 4tvf A: [260975]
    automated match to d1f25a_
    complexed with hem

Details for d4tvfa_

PDB Entry: 4tvf (more details), 1.9 Å

PDB Description: OxyB from Actinoplanes teichomyceticus
PDB Compounds: (A:) OxyB

SCOPe Domain Sequences for d4tvfa_:

Sequence, based on SEQRES records: (download)

>d4tvfa_ a.104.1.0 (A:) automated matches {Actinoplanes teichomyceticus [TaxId: 1867]}
sppihtrrqgfdpadelraagtltkisigsgadaettwlaaghavvrqvlgdhkrfstrr
rfdrrdeiggtgvfrprelvgnlmdydppehtrlrhlltpgftqrrmrrlaprieeivtd
rldameqagppadlielfadevpgavlceligvprddqamflqlchrhldaslsarkraa
ageafarylvammarerkdpgdgfigsivaehgdtitdeelrgvcvqlmlagddnvsgmi
glgvlallrhpeqiaalrgddqsadravdeliryltvpyaptprtavedvmvadqvikeg
etvlcslpmanrdrallpdadrldvtrtpvphvafghgihhclgaaltrlqlriaytalw
rrfpalqladpaqeimfrtstpaygltsllvaw

Sequence, based on observed residues (ATOM records): (download)

>d4tvfa_ a.104.1.0 (A:) automated matches {Actinoplanes teichomyceticus [TaxId: 1867]}
sppihtrrqgfdpadelraagtltkistwlaaghavvrqvlgdhkrfstrrelvgnlmdy
dppehtrlrhlltpgftqrrmrrlaprieeivtdrldameqagppadlielfadevpgav
lceligvprddqamflqlchrhafarylvammarerkdpgdgfigsivaehgdtitdeel
rgvcvqlmlagddnvsgmiglgvlallrhpeqiaalrgddqsadravdeliryltvpyap
tprtavedvmvadqvikegetvlcslpmanrdrallpdadrldvtrtpvphvafghgihh
clgaaltrlqlriaytalwrrfpalqladpaqeimfrtstpaygltsllvaw

SCOPe Domain Coordinates for d4tvfa_:

Click to download the PDB-style file with coordinates for d4tvfa_.
(The format of our PDB-style files is described here.)

Timeline for d4tvfa_: