| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
| Family c.57.1.0: automated matches [191349] (1 protein) not a true family |
| Protein automated matches [190284] (9 species) not a true protein |
| Species Mycobacterium ulcerans [TaxId:362242] [260972] (1 PDB entry) |
| Domain d4twgd_: 4twg D: [260974] automated match to d3pzya_ complexed with cit, edo |
PDB Entry: 4twg (more details), 1.85 Å
SCOPe Domain Sequences for d4twgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4twgd_ c.57.1.0 (D:) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
starsaqiiiastraasgvytdecgpiiaewleqrgfspleskvvadgnpvgealqdave
aqvdliitsggtgisptdstpeqtvavldfvipgladairraglpkvptsvlsrgvcgva
gqtlivnlpgspggvrdgldvladvvhhaldqiag
Timeline for d4twgd_: