| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Lactate dehydrogenase [51859] (19 species) |
| Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (39 PDB entries) |
| Domain d4rlsd1: 4rls D:1-159 [260970] Other proteins in same PDB: d4rlsa2, d4rlsb2, d4rlsc2, d4rlsd2 automated match to d1i10a1 complexed with 2op, 49c, nai, so4 |
PDB Entry: 4rls (more details), 1.91 Å
SCOPe Domain Sequences for d4rlsd1:
Sequence, based on SEQRES records: (download)
>d4rlsd1 c.2.1.5 (D:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig
>d4rlsd1 c.2.1.5 (D:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqsrlnlvqrnvnifkfiipnv
vkyspnckllivsnpvdiltyvawkisgfpknrvig
Timeline for d4rlsd1: