Lineage for d4rkrd_ (4rkr D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1878506Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 1878507Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 1878777Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 1878778Protein automated matches [190646] (60 species)
    not a true protein
  7. 1878825Species Arthrobacter sp. [TaxId:290399] [260960] (2 PDB entries)
  8. 1878833Domain d4rkrd_: 4rkr D: [260962]
    automated match to d2nzug_
    complexed with lbt

Details for d4rkrd_

PDB Entry: 4rkr (more details), 2.2 Å

PDB Description: crystal structure of laci family transcriptional regulator from arthrobacter sp. fb24, target efi-560007, complex with lactose
PDB Compounds: (D:) Transcriptional regulator, LacI family

SCOPe Domain Sequences for d4rkrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rkrd_ c.93.1.0 (D:) automated matches {Arthrobacter sp. [TaxId: 290399]}
rtsvglaipdltnpyfpafassvvelatlrgwhvvvddyghggrsgldavehlapqvdav
igylggyadqaqtvlgrrplivldenpggaagsinfdyqhaakvavaqlmdskrqhiayl
eagsasesdepvpctvrgkavagrldelgaswslivaeetaeaareaaaaflrehpetdg
ilafndlmaagvlkalsgsgrrvpedcavigmdgiplgellspqlstmaldlrevgraav
ellvgllsgavtpgsqssrttlkhrlvlreste

SCOPe Domain Coordinates for d4rkrd_:

Click to download the PDB-style file with coordinates for d4rkrd_.
(The format of our PDB-style files is described here.)

Timeline for d4rkrd_: