Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (26 species) not a true protein |
Species Clavularia sp. [TaxId:86521] [188532] (9 PDB entries) |
Domain d4r6da1: 4r6d A:2-216 [260956] Other proteins in same PDB: d4r6da2 automated match to d2btja_ complexed with cu |
PDB Entry: 4r6d (more details), 1.55 Å
SCOPe Domain Sequences for d4r6da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r6da1 d.22.1.0 (A:2-216) automated matches {Clavularia sp. [TaxId: 86521]} gvikpdmkiklkmegnvngyafviegegegkpydgtntinlevkegaplpfsydilttaf xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdisleedsfiyeiylkge nfppngpvmqkkttgwdastermyvrdgvlkgdvkhklllegggyyrvdfktiyrakkav klpdyhfvdhrieclnhdkdhnkvtvyesavar
Timeline for d4r6da1: